Rabbit Polyclonal STEAP1 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | STEAP1 antibody was raised against a 18 amino acid peptide from near the carboxy terminus of human STEAP1. |
Rabbit Polyclonal STEAP1 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | STEAP1 antibody was raised against a 18 amino acid peptide from near the carboxy terminus of human STEAP1. |
Rabbit Polyclonal STEAP1 Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | STEAP1 antibody was raised against a 16 amino acid peptide from near the center of human STEAP1. |
STEAP1 rabbit polyclonal antibody, Purified
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Immunogen | Spred1 antibody was raised against a 14 amino acid peptide near the center of the human Spred1. |
Rabbit Polyclonal Anti-STEAP1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-STEAP1 antibody: synthetic peptide directed towards the N terminal of human STEAP1. Synthetic peptide located within the following region: FYKIPILVINKVLPMVSITLLALVYLPGVIAAIVQLHNGTKYKKFPHWLD |
STEAP1 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human STEAP1 |
STEAP1 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-80 of human STEAP1 (NP_036581.1). |
| Modifications | Unmodified |