Germany
Japan
United Kingdom
China
STEAP4 Rabbit Polyclonal (Internal) Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | STEAP4 antibody was raised against synthetic peptide from human STEAP4. |
Antibodies
View as table Download
Goat Polyclonal Antibody against STEAP4 / Dudulin4
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence CVDNTLTRIRQGWERN, from the C Terminus of the protein sequence according to NP_078912.2. |
Rabbit Polyclonal STEAP4 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | STEAP4 antibody was raised against a 14 amino acid peptide from near the center of human STEAP4. |
Rabbit Polyclonal Anti-STEAP4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-STEAP4 antibody: synthetic peptide directed towards the C terminal of human STEAP4. Synthetic peptide located within the following region: AFLHVLYTLVIPIRYYVRWRLGNLTVTQAILKKENPFSTSSAWLSDSYVA |
Rabbit Polyclonal Anti-STEAP4 Antibody (N-Terminus)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | STEAP4 antibody was raised against synthetic 15 amino acid peptide from N-Terminus of human STEAP4. Percent identity with other species by BLAST analysis: Human (100%); Gorilla, Monkey, Marmoset (93%); Gibbon, Mouse, Bat, Horse (87%); Hamster, Elephant, Panda, Rabbit, Pig, Xenopus (80%). |
Anti-STEAP4 Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 441-456 amino acids of human STEAP family member 4 |
STEAP4 Antibody - C-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human STEAP4 |
Active filters
Target Symbol
- STEAP4