Antibodies

Jump to Filters
View as table Download
STIM2 (N-term) Rabbit Polyclonal Antibody
AP54073PU-N

USD 450.00

In Stock

STIM2 (N-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 97-127 amino acids from the N-terminal region of Human STIM2
STIM2 Rabbit Polyclonal Antibody
TA306423

USD 430.00

In Stock

Rabbit Polyclonal STIM2 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen STIM2 antibody was raised against a 17 amino acid peptide from near the center of human STIM2.
STIM2 Rabbit Polyclonal Antibody
AP22869PU-N

USD 525.00

2 Weeks

STIM2 rabbit polyclonal antibody, Aff - Purified

Applications ELISA, IHC, WB
Reactivities Human, Mouse, Rat
Immunogen STIM2 antibody was raised against synthetic peptide - KLH conjugated
STIM2 Rabbit Polyclonal Antibody
TA306422

USD 430.00

5 Days

Rabbit Polyclonal STIM2 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen STIM2 antibody was raised against a 18 amino acid peptide from near the carboxy terminus of human STIM2.
STIM2 Rabbit Polyclonal Antibody
TA328646

USD 585.00

3 Weeks

Rabbit Polyclonal Anti-STIM2

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide SAEKQWEVPDTASEC, corresponding to amino acid residues 583-597 of human STIM2. Intracellular, C-terminus.
STIM2 Rabbit Polyclonal Antibody
AP05701PU-N

USD 340.00

5 Days

STIM2 rabbit polyclonal antibody, Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat
Immunogen A 17 amino acid peptide located near the centre of human STIM2.
STIM2 Rabbit Polyclonal Antibody
TA343352

USD 375.00

5 Days

Rabbit Polyclonal Anti-STIM2 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Stim2 antibody is: synthetic peptide directed towards the C-terminal region of Mouse Stim2. Synthetic peptide located within the following region: IFSPASRVYNGILEKSCSMHQLSSGIPVPHPRHTSCSSAGNDSKPVQEAS
STIM2 Rabbit Polyclonal Antibody
TA382115

USD 220.00

3 Weeks

STIM2 Rabbit polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 60-180 of human STIM2 (NP_001162588).
Modifications Unmodified