Antibodies

Jump to Filters

View as table

Loading...

Download Close

Download

1 - 19 of 19 results

(reset)

STK3 Rabbit Polyclonal Antibody

TA346751

USD 410.00

5 Days

Rabbit Polyclonal Anti-STK3 Antibody

Applications	IHC, WB
Reactivities	Human, Mouse
Conjugation	Unconjugated
Immunogen	The immunogen for anti-STK3 antibody: synthetic peptide directed towards the C terminal of human STK3. Synthetic peptide located within the following region: IEHNSTMLESDLGTMVINSEDEEEEDGTMKRNATSPQVQRPSFMDYFDKQ

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

STK3 Rabbit Polyclonal Antibody

TA346750

USD 475.00

5 Days

Rabbit Polyclonal Anti-STK3 Antibody

Applications	WB
Reactivities	Human, Mouse
Conjugation	Unconjugated
Immunogen	The immunogen for anti-STK3 antibody: synthetic peptide directed towards the N terminal of human STK3. Synthetic peptide located within the following region: MEQPPAPKSKLKKLSEDSLTKQPEEVFDVLEKLGEGSYGSVFKAIHKESG

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

STK3 Mouse Monoclonal Antibody [Clone ID: OTI4G10]

CF500408

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) STK3 mouse monoclonal antibody, clone OTI4G10 (formerly 4G10)

Applications	IHC, WB
Reactivities	Human, Monkey, Mouse, Rat, Dog
Conjugation	Unconjugated

• 

1 / 13

2 / 13

3 / 13

4 / 13

5 / 13

6 / 13

7 / 13

8 / 13

9 / 13

10 / 13

11 / 13

12 / 13

13 / 13

Previous Next

STK3 Mouse Monoclonal Antibody [Clone ID: OTI2D4]

CF500409

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) STK3 mouse monoclonal antibody, clone OTI2D4 (formerly 2D4)

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 12

2 / 12

3 / 12

4 / 12

5 / 12

6 / 12

7 / 12

8 / 12

9 / 12

10 / 12

11 / 12

12 / 12

Previous Next

STK3 Rabbit Polyclonal Antibody

TA351035

USD 345.00

In Stock

Rabbit Polyclonal Anti-STK3/STK4 Antibody

Applications	IHC, WB
Reactivities	Human, Mouse
Conjugation	Unconjugated
Immunogen	Synthetic peptide of human STK3/STK4

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

STK3 Rabbit Polyclonal Antibody

TA363775

USD 360.00

5 Days

STK3 Antibody - middle region

Applications	WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	The immunogen is a synthetic peptide directed towards the middle region of human STK3

STK3 Rabbit Polyclonal Antibody

TA382129

USD 220.00

3 Weeks

STK3/MST2 Rabbit polyclonal Antibody

Applications	IF, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 323-450 of human STK3/MST2 (NP_006272.2).
Modifications	Unmodified

STK3 Rabbit Polyclonal Antibody

TA382130

USD 300.00

3 Weeks

Phospho-STK3/MST2-T117 Rabbit polyclonal Antibody

Applications	WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	A phospho specific peptide corresponding to residues surrounding T117 of human STK3/MST2.
Modifications	Phospho T117

STK3 Rabbit Polyclonal Antibody

TA382131

USD 300.00

3 Weeks

Phospho-STK3/MST2-T384 Rabbit polyclonal Antibody

Applications	WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	A phospho specific peptide corresponding to residues surrounding T384 of human STK3/MST2.
Modifications	Phospho T384

STK3 Rabbit Polyclonal Antibody

TA382132

USD 300.00

3 Weeks

Phospho-STK3/STK4-T180/T183 Rabbit polyclonal Antibody

Applications	WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	A phospho specific peptide corresponding to residues surrounding T180/T183 of human STK3/STK4.
Modifications	Phospho T180/T183

STK3 Rabbit Polyclonal Antibody

TA385350

USD 380.00

4 Weeks

STK3 Rabbit polyclonal Antibody

Applications	IHC, IP, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	A synthesized peptide derived from human STK3

1 / 2

2 / 2

Previous Next

STK3 Mouse Monoclonal Antibody [Clone ID: OTI4G10]

TA500408

USD 379.00

In Stock

Anti-STK3 mouse monoclonal antibody, clone OTI4G10 (formerly 4G10)

Applications	IHC, WB
Reactivities	Human, Monkey, Mouse, Rat, Dog
Conjugation	Unconjugated

• 

1 / 13

2 / 13

3 / 13

4 / 13

5 / 13

6 / 13

7 / 13

8 / 13

9 / 13

10 / 13

11 / 13

12 / 13

13 / 13

Previous Next

STK3 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI4G10]

TA500408AM

USD 420.00

4 Weeks

Anti-STK3 mouse monoclonal antibody, clone OTI4G10 (formerly 4G10), Biotinylated

Applications	IHC, WB
Reactivities	Human, Monkey, Mouse, Rat, Dog
Conjugation	Biotin

• 

1 / 13

2 / 13

3 / 13

4 / 13

5 / 13

6 / 13

7 / 13

8 / 13

9 / 13

10 / 13

11 / 13

12 / 13

13 / 13

Previous Next

STK3 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4G10]

TA500408BM

USD 420.00

4 Weeks

Anti-STK3 mouse monoclonal antibody, clone OTI4G10 (formerly 4G10), HRP conjugated

Applications	IHC, WB
Reactivities	Human, Monkey, Mouse, Rat, Dog
Conjugation	HRP

• 

1 / 13

2 / 13

3 / 13

4 / 13

5 / 13

6 / 13

7 / 13

8 / 13

9 / 13

10 / 13

11 / 13

12 / 13

13 / 13

Previous Next

STK3 Mouse Monoclonal Antibody [Clone ID: OTI4G10]

TA500408S

USD 159.00

2 Days

Anti-STK3 mouse monoclonal antibody, clone OTI4G10 (formerly 4G10)

Applications	IHC, WB
Reactivities	Human, Monkey, Mouse, Rat, Dog
Conjugation	Unconjugated

• 

1 / 13

2 / 13

3 / 13

4 / 13

5 / 13

6 / 13

7 / 13

8 / 13

9 / 13

10 / 13

11 / 13

12 / 13

13 / 13

Previous Next

STK3 Mouse Monoclonal Antibody [Clone ID: OTI2D4]

TA500409

USD 379.00

In Stock

Anti-STK3 mouse monoclonal antibody, clone OTI2D4 (formerly 2D4)

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 12

2 / 12

3 / 12

4 / 12

5 / 12

6 / 12

7 / 12

8 / 12

9 / 12

10 / 12

11 / 12

12 / 12

Previous Next

STK3 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2D4]

TA500409AM

USD 420.00

4 Weeks

Anti-STK3 mouse monoclonal antibody, clone OTI2D4 (formerly 2D4), Biotinylated

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Biotin

• 

1 / 12

2 / 12

3 / 12

4 / 12

5 / 12

6 / 12

7 / 12

8 / 12

9 / 12

10 / 12

11 / 12

12 / 12

Previous Next

STK3 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2D4]

TA500409BM

USD 420.00

4 Weeks

Anti-STK3 mouse monoclonal antibody, clone OTI2D4 (formerly 2D4), HRP conjugated

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	HRP

• 

1 / 12

2 / 12

3 / 12

4 / 12

5 / 12

6 / 12

7 / 12

8 / 12

9 / 12

10 / 12

11 / 12

12 / 12

Previous Next

STK3 Mouse Monoclonal Antibody [Clone ID: OTI2D4]

TA500409S

USD 159.00

2 Days

Anti-STK3 mouse monoclonal antibody, clone OTI2D4 (formerly 2D4)

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 12

2 / 12

3 / 12

4 / 12

5 / 12

6 / 12

7 / 12

8 / 12

9 / 12

10 / 12

11 / 12

12 / 12

Previous Next

1 - 19 of 19 results