Antibodies

Jump to Filters
View as table Download
STK32A (N-term) Rabbit Polyclonal Antibody
AP54075PU-N

USD 450.00

2 Weeks

STK32A (N-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse
Immunogen KLH conjugated synthetic peptide between 1-30 amino acids from the N-terminal region of human STK32A
STK32A Rabbit Polyclonal Antibody
TA340378

USD 375.00

5 Days

Rabbit Polyclonal Anti-STK32A Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-STK32A antibody: synthetic peptide directed towards the N terminal of human STK32A. Synthetic peptide located within the following region: GANTSRKPPVFDENEDVNFDHFEILRAIGKGSFGKVCIVQKNDTKKMYAM
STK32A Rabbit Polyclonal Antibody
TA351763

USD 345.00

In Stock

Rabbit Polyclonal Anti-STK32A Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human STK32A
STK32A Rabbit Polyclonal Antibody
TA366378

USD 380.00

4 Weeks

STK32A rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human STK32A
STK32A Rabbit Polyclonal Antibody
TA367294

USD 380.00

4 Weeks

STK32A rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human STK32A
STK32A Rabbit Polyclonal Antibody
TA370726

USD 380.00

4 Weeks

STK32A rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human STK32A
STK32A Rabbit Polyclonal Antibody
TA382134

USD 220.00

3 Weeks

STK32A Rabbit polyclonal Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-166 of human STK32A (NP_659438.1).
Modifications Unmodified