Antibodies

View as table Download

STK33 mouse monoclonal antibody, clone 3F10

Applications ELISA, IF, IHC, WB
Reactivities Human

Rabbit polyclonal anti-STK33 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from N-terminal of human STK33.

Rabbit Polyclonal STK33 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen A genomic peptide made to an internal region of the human Stk33 (within residues 1-150). [Swiss-Prot Q9BYT3]

STK33 (N-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 38-68 amino acids from the N-terminal region of human STK33

Rabbit Polyclonal Anti-STK33 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-STK33 antibody is: synthetic peptide directed towards the C-terminal region of Human STK33. Synthetic peptide located within the following region: NVLEMMKEWKNNPESVEENTTEEKNKPSTEEKLKSYQPWGNVPDANYTSD

Rabbit Polyclonal Anti-STK33 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-STK33 antibody is: synthetic peptide directed towards the N-terminal region of Human STK33. Synthetic peptide located within the following region: VPPVLVVEMSQTSSIGSAESLISLERKKEKNINRDITSRKDLPSRTSNVE

Rabbit Polyclonal Anti-STK33 Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human STK33

STK33 rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human STK33