Antibodies

Jump to Filters
View as table Download
STK35 Goat Polyclonal Antibody
TA302922

USD 375.00

5 Days

Goat Polyclonal Antibody against STK35

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence ELETRMDQVTCAA, from the C Terminus of the protein sequence according to NP_543026.1.
STK35 Rabbit Polyclonal Antibody
TA334386

USD 375.00

5 Days

Rabbit Polyclonal Anti-STK35 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-STK35 antibody is: synthetic peptide directed towards the C-terminal region of Human STK35. Synthetic peptide located within the following region: LENPKMELHIPQKRRTSMSEGIKQLLKDMLAANPQDRPDAFELETRMDQV
STK35 Rabbit Polyclonal Antibody
TA334387

USD 375.00

5 Days

Rabbit Polyclonal Anti-STK35 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-STK35 antibody is: synthetic peptide directed towards the N-terminal region of Human STK35. Synthetic peptide located within the following region: PPRPRAGRRDEAGGARAAPLLLPPPPAAMETGKDGARRGTQSPERKRRSP
STK35 Rabbit Polyclonal Antibody
TA351762

USD 345.00

In Stock

Rabbit Polyclonal Anti-STK35 Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human STK35
STK35 Rabbit Polyclonal Antibody
TA382135

USD 220.00

3 Weeks

STK35 Rabbit polyclonal Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 190-380 of human STK35 (NP_543026.2).
Modifications Unmodified