Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-STK38 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-STK38 antibody: synthetic peptide directed towards the C terminal of human STK38. Synthetic peptide located within the following region: IGAPGVEEIKSNSFFEGVDWEHIRERPAAISIEIKSIDDTSNFDEFPESD |
Goat Polyclonal Antibody against NDR1 / STK38
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-KPTVATSNHPET, from the C Terminus (near) of the protein sequence according to NP_009202.1. |
STK38 Rabbit polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human STK38 (NP_009202.1). |
| Modifications | Unmodified |
Active filters
Target Symbol
- STK38