Rabbit Polyclonal Anti-STRA8 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Stra8 antibody is: synthetic peptide directed towards the N-terminal region of Mouse Stra8. Synthetic peptide located within the following region: WFPSEAVGPDAEEEGEEEGEEEGEEGEEEEEGDEEGEEEEENGEEREVEE |
Rabbit polyclonal STRA8 Antibody (C-term)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This STRA8 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 286-315 amino acids from the C-terminal region of human STRA8. |
Rabbit Polyclonal Anti-STRA8 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Stra8 antibody is: synthetic peptide directed towards the C-terminal region of Mouse Stra8. Synthetic peptide located within the following region: FLDKSEAQHMSNISAMFATCNSENPEEKFQLYIQIIEFFKSLGCVNTPLN |
Anti-STRA8 Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 314-299 amino acids of human stimulated by retinoic acid 8 |
STRA8 Antibody - C-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
STRA8 Rabbit polyclonal Antibody
| Applications | ELISA, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from the Internal region of human STRA8. AA range:151-200 |
Germany
Japan
United Kingdom
China
