Rabbit polyclonal antibody to STYK1 (serine/threonine/tyrosine kinase 1)
Applications | IHC, WB |
Reactivities | Human |
Immunogen | Recombinant fragment corresponding to a region within amino acids 214 and 422 of STYK1 (Uniprot ID#Q6J9G0) |
Rabbit polyclonal antibody to STYK1 (serine/threonine/tyrosine kinase 1)
Applications | IHC, WB |
Reactivities | Human |
Immunogen | Recombinant fragment corresponding to a region within amino acids 214 and 422 of STYK1 (Uniprot ID#Q6J9G0) |
Rabbit Polyclonal Anti-Styk1 Antibody
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Styk1 antibody is: synthetic peptide directed towards the middle region of Mouse Styk1. Synthetic peptide located within the following region: YHIGKQILLALEFLQEKHLFHGDVAARNILIQSDLTPKLCHLGLAYEVHA |
Rabbit Polyclonal Anti-STYK1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-STYK1 antibody: synthetic peptide directed towards the C terminal of human STYK1. Synthetic peptide located within the following region: PERLLLRPASIRADVWSFGILLYEMVTLGAPPYPEVPPTSILEHLQRRKI |
Rabbit Polyclonal Anti-STYK1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human STYK1 |