Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit polyclonal Anti-SULF2 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SULF2 antibody: synthetic peptide directed towards the C terminal of human SULF2. Synthetic peptide located within the following region: DVLNQLHVQLMELRSCKGYKQCNPRTRNMDLGLKDGGSYEQYRQFQRRKW |
Goat Anti-SULF2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-DGRVYHVGLGDAAQPR , from the internal region of the protein sequence according to NP_061325.1; NP_940998.1. |
SULF2 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 726-870 of human SULF2 (NP_061325.1). |
| Modifications | Unmodified |
Active filters
Target Symbol
- SULF2