Germany
Japan
United Kingdom
China
Anti-SULT1A1 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Full length fusion protein |
Antibodies
View as table Download
SULT1A1 (Center) rabbit polyclonal antibody, Purified
| Applications | WB |
| Reactivities | Human, Mouse |
| Immunogen | This antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide selected from the central region of human SULT1A1. |
Rabbit polyclonal Anti-SULT1A1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SULT1A1 antibody: synthetic peptide directed towards the N terminal of human SULT1A1. Synthetic peptide located within the following region: ELIQDTSRPPLEYVKGVPLIKYFAEALGPLQSFQARPDDLLISTYPKSGT |
SULT1A1 Antibody - middlel region
| Applications | WB |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of mouse SULT1A1 |
SULT1A1 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-295 of human SULT1A1 (NP_803565.1). |
| Modifications | Unmodified |
SULT1A1 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-295 of human SULT1A1 (NP_803565.1). |
| Modifications | Unmodified |
USD 420.00
4 Weeks
SULT1A1 mouse monoclonal antibody, clone OTI8B8 (formerly 8B8)
| Applications | FC, IHC, WB |
| Reactivities | Human, Monkey |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
USD 420.00
4 Weeks
SULT1A1 mouse monoclonal antibody, clone OTI5F1 (formerly 5F1)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
USD 420.00
4 Weeks
USD 420.00
4 Weeks
SULT1A1 mouse monoclonal antibody, clone OTI1G10 (formerly 1G10)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
USD 420.00
4 Weeks
USD 420.00
4 Weeks
SULT1A1 mouse monoclonal antibody, clone OTI9D10 (formerly 9D10)
| Applications | FC, IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
USD 420.00
4 Weeks
SULT1A1 mouse monoclonal antibody, clone OTI9B7 (formerly 9B7)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
USD 420.00
4 Weeks
SULT1A1 mouse monoclonal antibody, clone OTI2C5 (formerly 2C5)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
USD 420.00
4 Weeks
SULT1A1 mouse monoclonal antibody, clone OTI5A1 (formerly 5A1)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
USD 420.00
4 Weeks
SULT1A1 mouse monoclonal antibody, clone OTI6C8 (formerly 6C8)
| Applications | FC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Active filters
Target Symbol
- SULT1A1