Rabbit Polyclonal Anti-SUPT5H Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-SUPT5H Antibody: synthetic peptide directed towards the C terminal of human SUPT5H. Synthetic peptide located within the following region: PYAAPSPQGSYQPSPSPQSYHQVAPSPAGYQNTHSPASYHPTPSPMAYQA |
Rabbit Polyclonal Anti-SUPT5H Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SUPT5H antibody: synthetic peptide directed towards the middle region of human SUPT5H. Synthetic peptide located within the following region: FEDQPEGIDLEVVTESTGKEREHNFQPGDNVEVCEGELINLQGKILSVDG |
SUPT5H Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human SUPT5H |
SUPT5H/SPT5 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 125-425 of human SUPT5H/SPT5 (NP_003160.2). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
