Antibodies

View as table Download

SUSD5 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 600-629 amino acids from the C-terminal region of human SUSD5

Rabbit Polyclonal Anti-SUSD5 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-SUSD5 Antibody is: synthetic peptide directed towards the middle region of Human SUSD5. Synthetic peptide located within the following region: PGLEKEVDDDTKKQFSAGDNHSGVKLVPGEPETKVIYGNTDGPSGPFVGK