Antibodies

Jump to Filters
View as table Download
SYCE2 (N-term) Rabbit Polyclonal Antibody
AP54118PU-N

USD 450.00

2 Weeks

SYCE2 (N-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 7-37 amino acids from the N-terminal region of human SYCE2
SYCE2 Rabbit Polyclonal Antibody
TA334098

USD 375.00

5 Days

Rabbit Polyclonal Anti-SYCE2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-SYCE2 Antibody is: synthetic peptide directed towards the C-terminal region of Human SYCE2. Synthetic peptide located within the following region: LKQVCHSVETVYKDLCLQPEQSLRLRWGPDHSRGKSPPRPGNSQPPDVFV