Germany
Japan
United Kingdom
China
SYNPR guinea pig polyclonal antibody, Serum
| Applications | IF, IHC |
| Reactivities | Human, Mouse, Rat |
| Immunogen | Synthetic C-terminal peptide CHSSGQRYLSDPMEKHS (corresponding to a part of the cytoplasmic carboxy terminus) conjugated to KLH. |
Antibodies
View as table DownloadRabbit Anti-synaptophysin 2 Antibody
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to amino acid residues from the C-terminal region conjugated to KLH |
Anti-Synpr Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide sequence around aa.257~261(G-P-T-S-F)derived from Rat synaptophysin 2. |
Rabbit Polyclonal Anti-SYNPR Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Synpr antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: LVGDSSSSAEFFVTVAVFAFLYSLAATVVYIFFQNKYRENNRGPLIDFIV |
SYNPR Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 196-265 of human SYNPR (NP_653243.1). |
| Modifications | Unmodified |
Active filters
Target Symbol
- SYNPR