Germany
Japan
United Kingdom
China
SYT2 pThr202 rabbit polyclonal antibody, Aff - Purified
| Applications | IF |
| Reactivities | Human, Mouse, Rat |
| Immunogen | Synthesized phosphopeptide derived from human Synaptotagmin II around the phosphorylation site of threonine 202 (R-K-TP-L-N) |
Antibodies
View as table Download
SYT2 pThr202 rabbit polyclonal antibody, Aff - Purified
| Applications | IF |
| Reactivities | Human, Mouse, Rat |
| Immunogen | Synthesized phosphopeptide derived from human Synaptotagmin II around the phosphorylation site of threonine 202 (R-K-TP-L-N) |
Goat Anti-SYT2 / Synaptotagmin-2 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-KPEEEVDALLGKNK, from the C Terminus of the protein sequence according to NP_796376.2. |
Phospho-SYT2-T202 Rabbit Polyclonal Antibody
| Applications | IF |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A phospho specific peptide corresponding to residues surrounding T202 of human SYT2 |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-SYT2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SYT2 antibody: synthetic peptide directed towards the C terminal of human SYT2. Synthetic peptide located within the following region: AIGKIFVGSNATGTELRHWSDMLANPRRPIAQWHSLKPEEEVDALLGKNK |
SYT2 rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human SYT2 |
Active filters
Target Symbol
- SYT2