Germany
Japan
United Kingdom
China
Rabbit polyclonal anti-SAA4 antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human SAA4. |
Antibodies
View as table Download
Rabbit Polyclonal Anti-SAA4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SAA4 antibody: synthetic peptide directed towards the middle region of human SAA4. Synthetic peptide located within the following region: AAKLISRSRVYLQGLIDYYLFGNSSTVLEDSKSNEKAEEWGRSGKDPDRF |
Rabbit Polyclonal Anti-SAA4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SAA4 antibody: synthetic peptide directed towards the middle region of human SAA4. Synthetic peptide located within the following region: RVYLQGLIDYYLFGNSSTVLEDSKSNEKAEEWGRSGKDPDRFRPDGLPKK |
SAA4 rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Full length fusion protein |
SAA4 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 50 to the C-terminus of human SAA4 (NP_006503.2). |
| Modifications | Unmodified |
Active filters
Target Symbol
- SAA4