Rabbit Polyclonal Anti-SBSPON Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SBSPON antibody: synthetic peptide directed towards the C terminal of human SBSPON. Synthetic peptide located within the following region: WMQYLREGYTVCVDCQPPAMNSVSLRCSGDGLDSDGNQTLHWQAIGNPRC |
Rabbit Polyclonal Anti-SBSPON Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SBSPON antibody: synthetic peptide directed towards the middle region of human SBSPON. Synthetic peptide located within the following region: LRCSGDGLDSDGNQTLHWQAIGNPRCQGTWKKVRRVDQCSCPAVHSFIFI |
SBSPON Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human RPESP |
Germany
Japan
United Kingdom
China