Antibodies

Jump to Filters
View as table Download
SCAMP3 Rabbit Polyclonal Antibody
TA308210

USD 415.00

2 Weeks

Rabbit Polyclonal antibody to SCAMP3 (secretory carrier membrane protein 3)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 165 of SCAMP3 (Uniprot ID#O14828)
SCAMP3 Rabbit Polyclonal Antibody
TA342621

USD 375.00

5 Days

Rabbit Polyclonal Anti-SCAMP3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SCAMP3 antibody is: synthetic peptide directed towards the N-terminal region of Human SCAMP3. Synthetic peptide located within the following region: QASAAAATAELLKKQEELNRKAEELDRRERELQHAALGGTATRQNNWPPL
SCAMP3 Rabbit Polyclonal Antibody
TA342622

USD 375.00

5 Days

Rabbit Polyclonal Anti-SCAMP3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SCAMP3 antibody: synthetic peptide directed towards the N terminal of human SCAMP3. Synthetic peptide located within the following region: FQPPPAYEPPAPAPLPPPSAPSLQPSRKLSPTEPKNYGSYSTQASAAAAT