Germany
Japan
United Kingdom
China
Secretogranin 3 (SCG3) (C-term) rabbit polyclonal antibody, Aff - Purified
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Immunogen | Synthetic peptide corresponding to a sequence near the C-terminal of human SCG3 |
Antibodies
View as table Download
Rabbit Polyclonal Anti-SCG3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SCG3 antibody: synthetic peptide directed towards the C terminal of human SCG3. Synthetic peptide located within the following region: LQTKNKLEKNATDNISKLFPAPSEKSHEETDSTKEEAAKMEKEYGSLKDS |
Anti-SCG3 Rabbit Polyclonal Antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 20-232 amino acids of human secretogranin III |
Scg3 Antibody - C-terminal region
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
SCG3 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 199-468 of human SCG3 (NP_037375.2). |
| Modifications | Unmodified |
Active filters
Target Symbol
- SCG3