Rabbit Polyclonal SCUBE1 Antibody
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | SCUBE1 antibody was raised against a 14 amino acid synthetic peptide near the center of human SCUBE1. |
Rabbit Polyclonal SCUBE1 Antibody
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | SCUBE1 antibody was raised against a 14 amino acid synthetic peptide near the center of human SCUBE1. |
Rabbit Polyclonal Anti-SCUBE1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SCUBE1 antibody is: synthetic peptide directed towards the N-terminal region of Human SCUBE1. Synthetic peptide located within the following region: PGYKGEGKQCEDIDECENDYYNGGCVHECINIPGNYRCTCFDGFMLAHDG |
Rabbit Polyclonal Anti-Scube1 Antibody
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Scube1 antibody is: synthetic peptide directed towards the C-terminal region of Mouse Scube1. Synthetic peptide located within the following region: NCHVTFVTLKCDSSKKRRRGRKSPSKEVSHITAEFEVEMKVDEASGTCEA |