Germany
Japan
United Kingdom
China
Mouse Monoclonal Syntenin Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Antibodies
View as table Download
Rabbit Polyclonal Anti-SDCBP Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-SDCBP Antibody: synthetic peptide directed towards the middle region of human SDCBP. Synthetic peptide located within the following region: VGIRRAEIKQGIREVILCKDQDGKIGLRLKSIDNGIFVQLVQANSPASLV |
Goat Polyclonal Antibody against SDCBP
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence SLEDLKVDKVIQAQ-C, from the N Terminus of the protein sequence according to NP_005616.2; NP_001007068.1; NP_001007069; NP_001007070.1; NP_001007071.1. |
Rabbit Polyclonal Anti-SDCBP Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-SDCBP Antibody: synthetic peptide directed towards the middle region of human SDCBP. Synthetic peptide located within the following region: NSPASLVGLRFGDQVLQINGENCAGWSSDKAHKVLKQAFGEKITMTIRDR |
Rabbit Polyclonal Anti-SDCBP Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-SDCBP Antibody: synthetic peptide directed towards the middle region of human SDCBP. Synthetic peptide located within the following region: NGKITSIVKDSSAARNGLLTEHNICEINGQNVIGLKDSQIADILSTSGTV |
Rabbit Polyclonal Anti-SDCBP Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human SDCBP |
Rabbit Polyclonal Anti-SDCBP Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Full length fusion protein |
SDCBP rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human SDCBP |
SDCBP rabbit polyclonal antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Full length fusion protein |
USD 420.00
5 Days
USD 420.00
5 Days
Active filters
Target Symbol
- SDCBP