Antibodies

Jump to Filters
View as table Download
SEPP1 (SELENOP) Rabbit Polyclonal Antibody
TA335922

USD 375.00

5 Days

Rabbit Polyclonal Anti-SEPP1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-SEPP1 Antibody: synthetic peptide directed towards the N terminal of human SEPP1. Synthetic peptide located within the following region: LGLALALCLLPSGGTESQDQSSLCKQPPAWSIRDQDPMLNSNGSVTVVAL
SEPP1 (SELENOP) Rabbit Polyclonal Antibody
TA350395

USD 345.00

In Stock

Rabbit Polyclonal Anti-SEPP1 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human SEPP1
SELENOP Rabbit Polyclonal Antibody
TA365005

USD 380.00

4 Weeks

SELENOP rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human SELENOP