Goat Anti-SFTPA1 / SFTPA2 (aa102-115) Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-HLDEELQATLHDFR, from the internal region of the protein sequence according to NP_005402.3; NP_001087239.2; NP_001158117.1; NP_001158118.1; NP_001092138.1. |
Rabbit Polyclonal Anti-SFTPA1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SFTPA1 antibody is: synthetic peptide directed towards the C-terminal region of Human SFTPA1. Synthetic peptide located within the following region: KYNTYAYVGLTEGPSPGDFRYSDGTPVNYTNWYRGEPAGRGKEQCVEMYT |
SFTPA1 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide of human SFTPA1 |
Anti-SFTPA1 Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 223-236 amino acids of human surfactant protein A1 |
Anti-SFTPA1 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 223-236 amino acids of human surfactant protein A1 |
Surfactant Protein A Mouse Monoclonal Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
SFTPA1 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human SFTPA1 |
Germany
Japan
United Kingdom
China
