Antibodies

Jump to Filters
View as table Download
Sfxn5 Rabbit Polyclonal Antibody
TA334376

USD 375.00

5 Days

Rabbit Polyclonal Anti-Sfxn5 Antibody

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-Sfxn5 antibody is: synthetic peptide directed towards the N-terminal region of Rat Sfxn5. Synthetic peptide located within the following region: NEQLWSAQKIKQAILHPDTNEKIFMPFRMSGYIPFGTPIVVGLLLPNQTL