Antibodies

Jump to Filters
View as table Download
NSP3 (SH2D3C) Rabbit Polyclonal Antibody
TA337811

USD 375.00

5 Days

Rabbit Polyclonal Anti-SH2D3C Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SH2D3C antibody: synthetic peptide directed towards the N terminal of human SH2D3C. Synthetic peptide located within the following region: AGSDYVKFSKEKYILDSSPEKLHKELEEELKLSSTDLRSHAWYHGRIPRE
NSP3 (SH2D3C) Rabbit Polyclonal Antibody
TA381455

USD 220.00

3 Weeks

SH2D3C Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human SH2D3C.