Antibodies

Jump to Filters
View as table Download
SH3BP5 Mouse Monoclonal Antibody [Clone ID: 2B3]
AM20973PU-N

USD 480.00

2 Weeks

SH3BP5 mouse monoclonal antibody, clone 2B3

Applications ELISA, IF, IHC, WB
Reactivities Human
SH3BP5 Rabbit Polyclonal Antibody
TA342928

USD 375.00

5 Days

Rabbit Polyclonal Anti-SH3BP5 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SH3BP5 antibody: synthetic peptide directed towards the C terminal of human SH3BP5. Synthetic peptide located within the following region: SGASSPECEVERGDRAEGAENKTSDKANNNRGLSSSSGSGGSSKSQSSTS
SH3BP5 Rabbit Polyclonal Antibody
TA342929

USD 375.00

5 Days

Rabbit Polyclonal Anti-SH3BP5 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SH3BP5 antibody: synthetic peptide directed towards the N terminal of human SH3BP5. Synthetic peptide located within the following region: MEAEQTKTRSELVHKETAARYNAAMGRMRQLEKKLKRAINKSKPYFELKA