Rabbit Polyclonal Anti-SHOX2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-SHOX2 Antibody: synthetic peptide directed towards the middle region of human SHOX2. Synthetic peptide located within the following region: SEARVQVWFQNRRAKCRKQENQLHKGVLIGAASQFEACRVAPYVNVGALR |
Rabbit Polyclonal Anti-SHOX2 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SHOX2 antibody: synthetic peptide directed towards the middle region of human SHOX2. Synthetic peptide located within the following region: PGSPRLTEVSPELKDRKEDAKGMEDEGQTKIKQRRSRTNFTLEQLNELER |
Rabbit Polyclonal Anti-SHOX2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-SHOX2 Antibody: synthetic peptide directed towards the N terminal of human SHOX2. Synthetic peptide located within the following region: EELTAFVSKSFDQKVKEKKEAITYREVLESGPLRGAKEPTGCTEAGRDDR |
Rabbit Polyclonal Anti-SHOX2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-SHOX2 Antibody: synthetic peptide directed towards the middle region of human SHOX2. Synthetic peptide located within the following region: SEARVQVWFQNRRAKCRKQENQLHKGVLIGAASQFEACRVAPYVNVGALR |
SHOX2 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 96-355 of human SHOX2 (NP_003021.3). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
