Germany
Japan
United Kingdom
China
CD172a (signal regulatory protein, SIRP), mouse anti rat, clone OX-41
| Applications | ELISA, IHC |
| Reactivities | Rat |
| Conjugation | Unconjugated |
Antibodies
View as table Download
Rabbit Polyclonal SIRP alpha Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | SIRP alpha antibody was raised against a peptide corresponding to amino acids near the carboxy terminus of human SIRP alpha 1? The sequences of the immunogenic peptide differ from those of mouse, rat and bovine by one amino acid. |
Rabbit Polyclonal Anti-SHPS1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SHPS1 Antibody: A synthesized peptide derived from human SHPS1 |
Rabbit Polyclonal Anti-SIRPA Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SIRPA antibody: synthetic peptide directed towards the C terminal of human SIRPA. Synthetic peptide located within the following region: QTSPQPASEDTLTYADLDMVHLNRTPKQPAPKPEPSFSEYASVQVPRK |
Carrier-free (BSA/glycerol-free) SIRPA mouse monoclonal antibody,clone OTI1G4
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
CD172a/SIRPα Rabbit polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 395-504 of human CD172a/SIRPα (NP_542970.1). |
| Modifications | Unmodified |
USD 420.00
4 Weeks
USD 420.00
4 Weeks
USD 420.00
4 Weeks
USD 420.00
4 Weeks
USD 420.00
4 Weeks
USD 420.00
4 Weeks
SIRPA mouse monoclonal antibody,clone OTI1G4
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
SIRPA mouse monoclonal antibody,clone OTI1G4, Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
USD 420.00
4 Weeks
SIRPA mouse monoclonal antibody,clone OTI1G4, HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
SIRPA mouse monoclonal antibody,clone OTI1G4
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
USD 420.00
4 Weeks
USD 420.00
4 Weeks
USD 420.00
4 Weeks
Active filters
Target Symbol
- SIRPA