Antibodies

Jump to Filters
View as table Download
SKAP55 (SKAP1) Rabbit Polyclonal Antibody
TA338987

USD 375.00

5 Days

Rabbit Polyclonal Anti-SKAP1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SKAP1 antibody: synthetic peptide directed towards the N terminal of human SKAP1. Synthetic peptide located within the following region: RDHILRGFQQIKARYYWDFQPQGGDIGQDSSDDNHSGTLGLSLTSDAPFL
SKAP55 (SKAP1) Rabbit Polyclonal Antibody
TA381521

USD 220.00

3 Weeks

SKAP1 Rabbit polyclonal Antibody

Applications WB
Reactivities Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-358 of human SKAP1 (NP_001068567.1).
Modifications Unmodified