Antibodies

Jump to Filters
View as table Download
SCAP2 (SKAP2) Rabbit Polyclonal Antibody
TA308273

USD 415.00

5 Days

Rabbit Polyclonal antibody to SCAP2 (src kinase associated phosphoprotein 2)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region within amino acids 296 and 359 of SCAP2 (Uniprot ID#O75563)
SCAP2 (SKAP2) Goat Polyclonal Antibody
TA302599

USD 375.00

5 Days

Goat Polyclonal Antibody against SCAP2 / PRAP

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-GLVPKAYIMEMYDI, from the C Terminus of the protein sequence according to NP_003921.2.
SCAP2 (SKAP2) Rabbit Polyclonal Antibody
TA334380

USD 375.00

5 Days

Rabbit Polyclonal Anti-SKAP2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SKAP2 antibody is: synthetic peptide directed towards the middle region of Human SKAP2. Synthetic peptide located within the following region: FEWQKRWCALSKTVFYYYGSDKDKQQKGEFAIDGYSVRMNNTLRKDGKKD
SCAP2 (SKAP2) Rabbit Polyclonal Antibody
TA381522

USD 220.00

3 Weeks

SKAP2 Rabbit polyclonal Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-120 of human SKAP2 (NP_003921.2).
Modifications Unmodified