Antibodies

Jump to Filters
View as table Download
SLBP Rabbit Polyclonal Antibody
TA345971

USD 475.00

5 Days

Rabbit Polyclonal Anti-SLBP Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SLBP antibody: synthetic peptide directed towards the middle region of human SLBP. Synthetic peptide located within the following region: INYGKNTIAYDRYIKEVPRHLRQPGIHPKTPNKFKKYSRRSWDQQIKLWK
SLBP Rabbit Polyclonal Antibody
TA381534

USD 220.00

3 Weeks

SLBP Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human SLBP.
Modifications Unmodified