Antibodies

Jump to Filters
View as table Download
SLC15A2 Rabbit Polyclonal Antibody
TA333731

USD 375.00

5 Days

Rabbit Polyclonal Anti-SLC15A2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-SLC15A2 Antibody: synthetic peptide directed towards the middle region of human SLC15A2. Synthetic peptide located within the following region: GNENNSLLIESIKSFQKTPHYSKLHLKTKSQDFHFHLKYHNLSLYTEHSV
SLC15A2 Rabbit Polyclonal Antibody
TA322235

USD 345.00

In Stock

Anti-SLC15A2 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 717-729 amino acids of human solute carrier family 15 (H+/peptide transporter), member 2
SLC15A2 Rabbit Polyclonal Antibody
TA322236

USD 345.00

In Stock

Anti-SLC15A2 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 717-729 amino acids of human solute carrier family 15 (H+/peptide transporter), member 2