Rabbit Polyclonal Anti-SLC22A1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SLC22A1 antibody: synthetic peptide directed towards the N terminal of human SLC22A1. Synthetic peptide located within the following region: LSCVDPLASLATNRSHLPLGPCQDGWVYDTPGSSIVTEFNLVCADSWKLD |
Rabbit Polyclonal Anti-SLC22A1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SLC22A1 antibody: synthetic peptide directed towards the C terminal of human SLC22A1. Synthetic peptide located within the following region: IAIQMICLVNAELYPTFVSGVGPACRGSDATSSRDQGGRFARDHEGRREP |
SLC22A1 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human SLC22A1 |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
