Antibodies

Jump to Filters
View as table Download
SLC22A24 Rabbit Polyclonal Antibody
TA335126

USD 375.00

5 Days

Rabbit polyclonal Anti-MGC34821 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MGC34821 antibody: synthetic peptide directed towards the middle region of human MGC34821. Synthetic peptide located within the following region: VFPILAVPVILLLPETRDLPLPNTIQDVENEKDSRNIKQEDTCMKVTQF
SLC22A24 Rabbit Polyclonal Antibody
TA365792

USD 380.00

4 Weeks

SLC22A24 rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human SLC22A24
SLC22A24 Rabbit Polyclonal Antibody
TA370132

USD 380.00

4 Weeks

SLC22A24 rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human SLC22A24