Rabbit Polyclonal antibody to SLC25A13 (solute carrier family 25, member 13 (citrin))
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 248 and 535 of SLC25A13 (Uniprot ID#Q9UJS0) |
Rabbit Polyclonal Anti-SLC25A13 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-SLC25A13 Antibody is: synthetic peptide directed towards the C-terminal region of Human SLC25A13. Synthetic peptide located within the following region: RINLPAPNPDHVGGYKLAVATFAGIENKFGLYLPLFKPSVSTSKAIGGGP |
SLC25A13 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-300 of human SLC25A13 (NP_001153682.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
