Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-SLC25A21 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-SLC25A21 Antibody: synthetic peptide directed towards the N terminal of human SLC25A21. Synthetic peptide located within the following region: FYKGILPPILAETPKRAVKFFTFEQYKKLLGYVSLSPALTFAIAGLGSGL |
Rabbit Polyclonal Anti-SLC25A21 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-SLC25A21 Antibody: synthetic peptide directed towards the middle region of human SLC25A21. Synthetic peptide located within the following region: LLSGTIASVINIPFDVAKSRIQGPQPVPGEIKYRTCFKTMATVYQEEGIL |
Active filters
Target Symbol
- SLC25A21