Rabbit Polyclonal Anti-SLC26A4 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SLC26A4 antibody: synthetic peptide directed towards the middle region of human SLC26A4. Synthetic peptide located within the following region: ELNDRFRHKIPVPIPIEVIVTIIATAISYGANLEKNYNAGIVKSIPRGFL |
SLC26A4 Antibody - middlel region
| Applications | WB |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of mouse SLC26A4 |
SLC26A4 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 250-350 of human SLC26A4 (NP_000432.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
