Antibodies

Jump to Filters
View as table Download
FATP2 (SLC27A2) Rabbit Polyclonal Antibody
TA333990

USD 375.00

5 Days

Rabbit Polyclonal Anti-SLC27A2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-SLC27A2 Antibody: synthetic peptide directed towards the N terminal of human SLC27A2. Synthetic peptide located within the following region: LLFRDETLTYAQVDRRSNQVARALHDHLGLRQGDCVALLMGNEPAYVWLW
FATP2 (SLC27A2) Rabbit Polyclonal Antibody
TA350424

USD 345.00

In Stock

Rabbit Polyclonal Anti-SLC27A2 Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human SLC27A2
SLC27A2 Rabbit Polyclonal Antibody
TA365020

USD 380.00

4 Weeks

SLC27A2 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human SLC27A2