Germany
Japan
United Kingdom
China
Rabbit polyclonal anti-SLC27A4 antibody
| Applications | IF |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human SLC27A4. |
Antibodies
View as table Download
Rabbit polyclonal anti-FATP4 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide surrounding amino acid 598 of rat FATP4 |
Rabbit Polyclonal Anti-SLC27A4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-SLC27A4 Antibody: synthetic peptide directed towards the middle region of human SLC27A4. Synthetic peptide located within the following region: YKFQKTELRKEGFDPAIVKDPLFYLDAQKGRYVPLDQEAYSRIQAGEEKL |
SLC27A4 rabbit polyclonal antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human SLC27A4 |
SLC27A4 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 574-643 of human SLC27A4 (NP_005085.2). |
| Modifications | Unmodified |
Active filters
Target Symbol
- SLC27A4