Germany
Japan
United Kingdom
China
Antibodies
View as table Download
SLC32A1 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide of human SLC32A1 |
Rabbit Polyclonal Anti-Vesicular GABA Transporter
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide (C)GEFGGHDKPKITAWE, corresponding to amino acid residues 106-120 of rat vesicular GABA transporter. Cytoplasmic, N-terminus |
Rabbit Anti-Vesicular GABA transporter (VGAT) Antibody
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to amino acid residues from the N-terminal region conjugated to KLH |
Rabbit Polyclonal Anti-SLC32A1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-SLC32A1 Antibody: synthetic peptide directed towards the N terminal of human SLC32A1. Synthetic peptide located within the following region: GDEGAEAPVEGDIHYQRGSGAPLPPSGSKDQVGGGGEFGGHDKPKITAWE |
Anti-SLC32A1 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 63-76 amino acids of human solute carrier family 32 (GABA vesicular transporter), member 1 |
Anti-SLC32A1 Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 63-76 amino acids of human solute carrier family 32 (GABA vesicular transporter), member 1 |
Rabbit Polyclonal Anti-SLC32A1 Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human SLC32A1 |
SLC32A1 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-120 of human SLC32A1 (NP_542119.1). |
| Modifications | Unmodified |
Active filters
Target Symbol
- SLC32A1