Antibodies

View as table Download

Rabbit Polyclonal Anti-SLC38A3 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-SLC38A3 antibody: synthetic peptide directed towards the N terminal of human SLC38A3. Synthetic peptide located within the following region: GNQRVEDPARSCMEGKSFLQKSPSKEPHFTDFEGKTSFGMSVFNLSNAIM

SLC38A3 (Center) rabbit polyclonal antibody

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide selected from the Center region of human SLC38A3

SLC38A3 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-65 of human SLC38A3 (NP_006832.1).
Modifications Unmodified