Antibodies

Jump to Filters
View as table Download
SLC44A4 Rabbit Polyclonal Antibody
TA329498

USD 375.00

Backordered

Rabbit Polyclonal Anti-SLC44A4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-SLC44A4 antibody is: synthetic peptide directed towards the middle region of Human SLC44A4. Synthetic peptide located within the following region: MMSTMFYPLVTFVLLLICIAYWAMTALYLATSGQPQYVLWASNISSPGCE
SLC44A4 Rabbit Polyclonal Antibody
TA381667

USD 220.00

3 Weeks

SLC44A4 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 65-215 of human SLC44A4 (NP_079533.2).
Modifications Unmodified