Antibodies

Jump to Filters
View as table Download
SLC6A14 Rabbit Polyclonal Antibody
TA333895

USD 375.00

5 Days

Rabbit Polyclonal Anti-SLC6A14 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-SLC6A14 Antibody: synthetic peptide directed towards the middle region of human SLC6A14. Synthetic peptide located within the following region: VFAGFAIFSILGHMAHISGKEVSQVVKSGFDLAFIAYPEALAQLPGGPFW
SLC6A14 Rabbit Polyclonal Antibody
TA381690

USD 220.00

3 Weeks

SLC6A14 Rabbit polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 131-234 of human SLC6A14 (NP_009162.1).
Modifications Unmodified