Rabbit Polyclonal Anti-SLC6A8 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SLC6A8 antibody: synthetic peptide directed towards the N terminal of human SLC6A8. Synthetic peptide located within the following region: CDQLADRRSPVIEFWENKVLRLSGGLEVPGALNWEVTLCLLACWVLVYFC |
Goat Anti-Creatine transporter 1 / SLC6A8 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence ASLANLTCDQLADRR, from the internal region of the protein sequence according to NP_005620.1; NP_001136277.1; NP_001136278.1. |
Rabbit Polyclonal Anti-SLC6A8 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SLC6A8 antibody: synthetic peptide directed towards the middle region of human SLC6A8. Synthetic peptide located within the following region: VFSILGFMAAEQGVHISKVAESGPGLAFIAYPRAVTLMPVAPLWAALFFF |
Rabbit polyclonal anti-SLC6A8 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human SLC6A8. |
SLC6A8 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 539-635 of human SLC6A8 (NP_005620.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
