Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-Slc6a9 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Slc6a9 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: FQLCRTDGDTLLQRLKNATKPSRDWGPALLEHRTGRYAPTTTPSPEDGFE |
Rabbit Polyclonal Anti-Glycine Transporter 1 (GlyT1) (extracellular)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide (C)RLYVLKLSDDIGD, corresponding to amino acid residues 202-214 of rat Glycine Transporter 1. 2nd extracellular loop. |
Rabbit Polyclonal anti-SLC6A9 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-SLC6A9 antibody is: synthetic peptide directed towards the N-terminal region of Human SLC6A9. Synthetic peptide located within the following region: ARPRMAAAHGPVAPSSPEQNGAVPSEATKRDQNLKRGNWGNQIEFVLTSV |
SLC6A9 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of Human SC6A9 |
SLC6A9 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human SLC6A9 |
SLC6A9 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-110 of human SLC6A9 (NP_964012.2). |
Active filters
Target Symbol
- SLC6A9