Rabbit Polyclonal Anti-SLC7A1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-SLC7A1 Antibody: synthetic peptide directed towards the N terminal of human SLC7A1. Synthetic peptide located within the following region: ELWAFITGWNLILSYIIGTSSVARAWSATFDELIGRPIGEFSRTHMTLNA |
Rabbit Polyclonal Anti-SLC7A1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-SLC7A1 Antibody: synthetic peptide directed towards the N terminal of human SLC7A1. Synthetic peptide located within the following region: LGFIMVSGFVKGSVKNWQLTEEDFGNTSGRLCLNNDTKEGKPGVGGFMPF |
SLC7A1 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human SLC7A1 |
SLC7A1 Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide of human SLC7A1 |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China