Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit polyclonal anti-NHERF1/ EBP50 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide surrounding amino acid 338of rat NHERF1 |
Rabbit polyclonal Anti-NHERF-1
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide (C)IQKENSREALVEPA, corresponding to residues 261-274 of rat NHERF-1. Between the PDZ2 and the ERM binding domains. |
Rabbit Polyclonal Anti-SLC9A3R1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-SLC9A3R1 Antibody is: synthetic peptide directed towards the C-terminal region of Human SLC9A3R1. Synthetic peptide located within the following region: RSASSDTSEELNSQDSPPKQDSTAPSSTSSSDPILDFNISLAMAKERAHQ |
SLC9A3R1 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the N-terminal region of Human NHRF1 |
SLC9A3R1 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 189-358 of human SLC9A3R1 (NP_004243.1). |
| Modifications | Unmodified |
Active filters
Target Symbol
- SLC9A3R1