Antibodies

View as table Download

ANKRD32 (SLF1) (78-91) rabbit polyclonal antibody, Aff - Purified

Applications ELISA, WB
Reactivities Bovine, Canine, Chimpanzee, Human, Mouse, Porcine, Rat
Immunogen Synthetic peptide corresponding to amino acids 78-91 of Human Hallen

Rabbit Polyclonal Anti-ANKRD32 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ANKRD32 antibody: synthetic peptide directed towards the N terminal of human ANKRD32. Synthetic peptide located within the following region: TNSVWTEHSNEETNKDFRKDAGFLEMKGALRETMYRTQKEMQNHEDVNVG